PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009793574.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family bZIP
Protein Properties Length: 436aa    MW: 46943.6 Da    PI: 9.7356
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009793574.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_146.96.1e-15358409556
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                     +r+rr++kNRe+A rsR+RK+a++ eLe +v++L++eN++L+k+ ee+ ++ 
  XP_009793574.1 358 RRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKEENEELQKKQEEMLEMQ 409
                     79***************************************98887766654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.9E-14354419IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.542356405IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.88E-11358407No hitNo description
PfamPF001707.2E-13358410IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.0E-14358407No hitNo description
CDDcd147076.22E-29358412No hitNo description
PROSITE patternPS000360361376IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 436 aa     Download sequence    Send to blast
MGSNFNFKNF GNEPPGEGGS SVGGKQPGNF QLPRQPSIYS LTFDEFLSTT GGSGKDFGSM  60
NMDELLKNIW NAEESQTMGG SGINGQEVGS VQSGNLQRQG SLTLPRTLSH KTVDEVWKDM  120
SKEYGGGKDG NSIGVSATLP QRQQTLGEIT LEEFLVRAGV VREDAQLAAK SNNVGGIFAD  180
LSYAGNNTGV GFGYQQANRN TGETGIQAAN LPLNVNGVRT QQQLRAQQLQ QQQPQPQQQQ  240
PQQQPLFPKQ PALAYAAPMA IPNNGQLGSP GMRGGLVGIS DPALNSNFVQ GAALTGGGMG  300
MVGLGAGAVT VATASPAVSS DGLGKSSGDT PSVSPLPYVF NGGIRGRKYS TVEKVVERRQ  360
RRMIKNRESA ARSRARKQAY TMELEAEVAK LKEENEELQK KQEEMLEMQK NQVMEMMNLQ  420
REAKRRCLRR TQTGPW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF7368500.0KF736850.1 Nicotiana tabacum ABRE binding factor (ABF2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009793574.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5
SwissprotQ9M7Q41e-128AI5L5_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 5
TrEMBLV9XND30.0V9XND3_TOBAC; ABRE binding factor
STRINGPGSC0003DMT4000206700.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7762497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G45249.15e-92abscisic acid responsive elements-binding factor 2